PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004502331.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Trihelix
Protein Properties Length: 382aa    MW: 43824.3 Da    PI: 6.0396
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004502331.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix85.66.2e-2771153286
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     W ++e++ Li +rrem++ ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k+++++++   s +++ +++++
  XP_004502331.1  71 WVQDETRSLIGLRREMDSLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGGS--GSAKMSCYKEID 153
                     ********************************************************************984..445788899887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-462132IPR009057Homeodomain-like
PROSITE profilePS500908.45563127IPR017877Myb-like domain
SMARTSM007170.001567129IPR001005SANT/Myb domain
CDDcd122031.69E-2869134No hitNo description
PfamPF138374.1E-2070155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MYLSSEKPRP IDFYKEEARD MMMEVVTSSD LPPPPPPHHH QPQPQMILNA ESSGEDPEME  60
IKAPKKRAET WVQDETRSLI GLRREMDSLF NTSKSNKHLW EQISAKMREK GFDRSPTMCT  120
DKWRNLLKEF KKAKHQDRGG SGSAKMSCYK EIDEILRERN KCTQQYKSPT PTSKVESYMQ  180
FSDKGIDDAN ISFGPVEASG RPTLNLERGL DHDGHPLAIA ADAVAASGVP PWNWRETPGN  240
GGESQSCCGR VISVKWGDYT RRIGIDGTPE AIKEAIRAAF RLRTKRAFWL EDEEQIIRSI  300
DREMPIGNYT LHLDEGMAIK VCLYDESDHI PVHTEDKIFY TEDDYRDFLA RRAWTCLREF  360
DGYRNIDNMD DLRPGAIYRG VS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A4e-4765151186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1367840.0BT136784.1 Medicago truncatula clone JCVI-FLMt-18L18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004502331.10.0PREDICTED: trihelix transcription factor GT-4
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A151SPA30.0A0A151SPA3_CAJCA; Uncharacterized protein
TrEMBLG7J2H90.0G7J2H9_MEDTR; Trihelix transcription factor
STRINGGLYMA11G37390.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68173248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-180Trihelix family protein